SUPERFAMILY 1.73 HMM library and genome assignments server

  Home > Genomes > Escherichia coli K-12 subMG1655 > gi|16130414|ref|NP_416984.1|

Domain assignment for gi|16130414|ref|NP_416984.1| from Escherichia coli K-12 subMG1655

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  gi|16130414|ref|NP_416984.1|
Domain Number 1 Region: 31-164
Classification Level Classification E-value
Superfamily HydA/Nqo6-like 2.11e-44
Family Nq06-like 0.00045
Further Details:      
 

Protein sequence

External link(s) gi|16130414|ref|NP_416984.1|
Sequence length 252
Comment hydrogenase 4, Fe-S subunit [Escherichia coli str. K-12 substr. MG1655]
Sequence 
MSPVLTQHVSQPITLDEQTQKMKRHLLQDIRRSAYVYRVDCGGCNACEIEIFAAITPVFD
AERFGIKVVSSPRHADILLFTGAVTRAMRMPALRAYESAPDHKICVSYGACGVGGGIFHD
LYSVWGGSDTIVPIDVWIPGCPPTPAATIHGFAVALGLLQQKIHAVDYRDPTGVTMQPLW
PQIPPSQRIAIEREARRLAGYRQGREICDRLLRHLSDDPTGNRVNTWLRDADDPRLNSIV
QQLFRVLRGLHD
Download sequence
Identical sequences B1XAW4 B3II78 P77668 Q31Y01
gi|89109295|ref|AP_003075.1| gi|82544938|ref|YP_408885.1| ER38 gi|238901654|ref|YP_002927450.1| gi|170082099|ref|YP_001731419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@mrc-lmb.cam.ac.uk or use the feedback form.

© Copyright 2001-2010 The Medical Research Council and the SUPERFAMILY authors; Derek Wilson, Martin Madera and Julian Gough.